SCOPe 2.08: Domain d4etqb2: 4etq B:111-213

Lineage for d4etqb2 (4etq B:111-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4etqb2: 4etq B:111-213 [220803]
   Other proteins in same PDB: d4etqa1, d4etqa2, d4etqb1, d4etqc_, d4etqh1, d4etqh2, d4etql1, d4etqx_
   automated match to d2fbjl2
   complexed with cl, edo, gol, scn

Details for d4etqb2

PDB Entry: 4etq, 2.1 Å

PDB Description: Vaccinia virus D8L IMV envelope protein in complex with Fab of murine IgG2a LA5

PDB Compounds: (B:) anti-vaccinia D8L antigen murine monoclonal IgG2a antibody LA5, light chain

SCOPe Domain Sequences for d4etqb2:

Sequence; same for both SEQRES and ATOM records:

>d4etqb2 b.1.1.2 (B:111-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4etqb2:

• d4etqb2 first appeared in SCOPe 2.03
  
• d4etqb2 appears in SCOPe 2.07