Lineage for d4epya_ (4epy A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1847028Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)
  8. 1847076Domain d4epya_: 4epy A: [220770]
    automated match to d4epxa_
    complexed with 0qy, gdp, mg

Details for d4epya_

PDB Entry: 4epy (more details), 1.8 Å

PDB Description: Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-mediated Activation
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d4epya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4epya_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

SCOPe Domain Coordinates for d4epya_:

Click to download the PDB-style file with coordinates for d4epya_.
(The format of our PDB-style files is described here.)

Timeline for d4epya_: