Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
Protein automated matches [196989] (16 species) not a true protein |
Species Mycobacterium leprae [TaxId:561304] [226361] (1 PDB entry) |
Domain d4eo9a_: 4eo9 A: [220757] automated match to d2h4xb_ complexed with cl |
PDB Entry: 4eo9 (more details), 2.45 Å
SCOPe Domain Sequences for d4eo9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eo9a_ c.60.1.0 (A:) automated matches {Mycobacterium leprae [TaxId: 561304]} ntatlillrhgesdwnarnlftgwvdvgltdkgraeavrsgellaehnllpdvlytsllr raittahlaldtadwlwipvrrswrlnerhygalqgldkavtkarygeerfmawrrsydt ppppiekgsefsqdadprytdigggpltecladvvtrflpyftdvivpdlrtgrtvliva hgnslralvkhldemsddevvglnvptgiplrydldadlrpvvpggtyldpeaaaavisq
Timeline for d4eo9a_: