SCOPe 2.08: Domain d4envd2: 4env D:598-753

Lineage for d4envd2 (4env D:598-753)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226043] (19 PDB entries)

8. Domain d4envd2: 4env D:598-753 [220744]
   Other proteins in same PDB: d4enva1, d4envb1, d4envc1, d4envd1
   automated match to d1p80a1
   complexed with hdd, hem

Details for d4envd2

PDB Entry: 4env, 1.7 Å

PDB Description: Structure of the S234I variant of E. coli KatE

PDB Compounds: (D:) catalase hpii

SCOPe Domain Sequences for d4envd2:

Sequence; same for both SEQRES and ATOM records:

>d4envd2 c.23.16.0 (D:598-753) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d4envd2:

• d4envd2 first appeared in SCOPe 2.03
  
• d4envd2 appears in SCOPe 2.07