Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.20: Clc chloride channel [81341] (1 superfamily) core: 18 transmembrane helices |
Superfamily f.20.1: Clc chloride channel [81340] (1 family) |
Family f.20.1.1: Clc chloride channel [69912] (2 proteins) duplication: consist of two similar structural parts |
Protein automated matches [226846] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [224947] (14 PDB entries) |
Domain d4eneb_: 4ene B: [220680] Other proteins in same PDB: d4enec1, d4enec2, d4ened1, d4ened2, d4enee1, d4enee2, d4enef1, d4enef2 automated match to d1kpla_ complexed with cl, dmu, mal |
PDB Entry: 4ene (more details), 2.4 Å
SCOPe Domain Sequences for d4eneb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eneb_ f.20.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla qftggkplysailartlakqea
Timeline for d4eneb_: