Lineage for d4eneb_ (4ene B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024422Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 3024423Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 3024424Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 3024472Protein automated matches [226846] (4 species)
    not a true protein
  7. 3024473Species Escherichia coli K-12 [TaxId:83333] [224947] (14 PDB entries)
  8. 3024475Domain d4eneb_: 4ene B: [220680]
    Other proteins in same PDB: d4enec1, d4enec2, d4ened1, d4ened2, d4enee1, d4enee2, d4enef1, d4enef2
    automated match to d1kpla_
    complexed with cl, dmu

Details for d4eneb_

PDB Entry: 4ene (more details), 2.4 Å

PDB Description: structure of the n- and c-terminal trimmed clc-ec1 cl-/h+ antiporter and fab complex
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d4eneb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eneb_ f.20.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqea

SCOPe Domain Coordinates for d4eneb_:

Click to download the PDB-style file with coordinates for d4eneb_.
(The format of our PDB-style files is described here.)

Timeline for d4eneb_: