Lineage for d4eloc_ (4elo C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916282Species Thermus thermophilus HB8 [TaxId:300852] [226637] (8 PDB entries)
  8. 2916291Domain d4eloc_: 4elo C: [220618]
    automated match to d1xvya_

Details for d4eloc_

PDB Entry: 4elo (more details), 1.91 Å

PDB Description: Ferric binding protein in apo form 1
PDB Compounds: (C:) Iron ABC transporter, periplasmic iron-binding protein

SCOPe Domain Sequences for d4eloc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eloc_ c.94.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tltiysgrgqslveplvkqfeaetgirvqvrystdaqilaalqeegsrspadlfwantag
algqasakgllrplgetllekpiafvpasrtwvpvtvrlrvlaynpdrikaeelpeslld
lprfarekglvgrvgwtptyssfqdmvagmialygeektrewllamkalapkaypsnpam
ldairagevdlgstnhyyvvrfrragyrlgmhhfrdgdagnlalvtgagllktsknlaaa
trfltyllspqaqqyfvgnigeyplvkgvaldpnllpleealakspkldleklpldralr
llretgvl

SCOPe Domain Coordinates for d4eloc_:

Click to download the PDB-style file with coordinates for d4eloc_.
(The format of our PDB-style files is described here.)

Timeline for d4eloc_: