Lineage for d4elkb2 (4elk B:117-244)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2030704Domain d4elkb2: 4elk B:117-244 [220611]
    Other proteins in same PDB: d4elka1, d4elkb1, d4elkc1, d4elkd1
    automated match to d1ktke2
    complexed with act, fmt, mli

Details for d4elkb2

PDB Entry: 4elk (more details), 2.1 Å

PDB Description: Crystal structure of the Hy19.3 type II NKT TCR
PDB Compounds: (B:) Hy19.3 TCR beta chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4elkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elkb2 b.1.1.2 (B:117-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4elkb2:

Click to download the PDB-style file with coordinates for d4elkb2.
(The format of our PDB-style files is described here.)

Timeline for d4elkb2: