Lineage for d4elkb1 (4elk B:3-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759682Domain d4elkb1: 4elk B:3-116 [220610]
    Other proteins in same PDB: d4elka2, d4elkb2, d4elkc2, d4elkd2
    automated match to d1ktke1
    complexed with act, fmt, mli

Details for d4elkb1

PDB Entry: 4elk (more details), 2.1 Å

PDB Description: Crystal structure of the Hy19.3 type II NKT TCR
PDB Compounds: (B:) Hy19.3 TCR beta chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4elkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elkb1 b.1.1.0 (B:3-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pkvlqipshqiidmgqmvtlncdpvsnhlyfywykqilgqqmeflvnfyngkvmeksklf
kdqfsverpdgsyftlkiqptaledsavyfcassfwgayaeqffgpgtrltvle

SCOPe Domain Coordinates for d4elkb1:

Click to download the PDB-style file with coordinates for d4elkb1.
(The format of our PDB-style files is described here.)

Timeline for d4elkb1: