Lineage for d1jrhi_ (1jrh I:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105363Protein Interferon-gamma receptor alpha chain [49293] (1 species)
  7. 105364Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
  8. 105369Domain d1jrhi_: 1jrh I: [22059]
    Other proteins in same PDB: d1jrhh1, d1jrhh2, d1jrhl1, d1jrhl2

Details for d1jrhi_

PDB Entry: 1jrh (more details), 2.8 Å

PDB Description: complex (antibody/antigen)

SCOP Domain Sequences for d1jrhi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrhi_ b.1.2.1 (I:) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
svptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycni
sdhvgdpsnslwvrvkarvgqkesayakseefavs

SCOP Domain Coordinates for d1jrhi_:

Click to download the PDB-style file with coordinates for d1jrhi_.
(The format of our PDB-style files is described here.)

Timeline for d1jrhi_: