Lineage for d4ejob_ (4ejo B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480012Species Eggerthella lenta [TaxId:479437] [226359] (1 PDB entry)
  8. 1480014Domain d4ejob_: 4ejo B: [220587]
    automated match to d1xmab_
    complexed with eoh

Details for d4ejob_

PDB Entry: 4ejo (more details), 2.1 Å

PDB Description: Crystal structure of padr family transcriptional regulator from Eggerthella lenta DSM 2243
PDB Compounds: (B:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d4ejob_:

Sequence, based on SEQRES records: (download)

>d4ejob_ a.4.5.0 (B:) automated matches {Eggerthella lenta [TaxId: 479437]}
amayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmrrl
esqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletngedr

Sequence, based on observed residues (ATOM records): (download)

>d4ejob_ a.4.5.0 (B:) automated matches {Eggerthella lenta [TaxId: 479437]}
amayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipitlyplmrrlesq
gllasewdnggkprkyyrttdeglrvlreveaqwhvlcdgvgklletngedr

SCOPe Domain Coordinates for d4ejob_:

Click to download the PDB-style file with coordinates for d4ejob_.
(The format of our PDB-style files is described here.)

Timeline for d4ejob_: