Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (68 species) not a true protein |
Species Eggerthella lenta [TaxId:479437] [226359] (2 PDB entries) |
Domain d4ejoa1: 4ejo A:1-111 [220586] Other proteins in same PDB: d4ejoa2, d4ejob2 automated match to d1xmab_ complexed with eoh |
PDB Entry: 4ejo (more details), 2.1 Å
SCOPe Domain Sequences for d4ejoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ejoa1 a.4.5.0 (A:1-111) automated matches {Eggerthella lenta [TaxId: 479437]} mayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmrrle sqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletn
Timeline for d4ejoa1: