Lineage for d4ei6d2 (4ei6 D:116-243)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752335Domain d4ei6d2: 4ei6 D:116-243 [220561]
    Other proteins in same PDB: d4ei6a1, d4ei6b1, d4ei6c1, d4ei6d1
    automated match to d1ktke2

Details for d4ei6d2

PDB Entry: 4ei6 (more details), 1.6 Å

PDB Description: Structure of XV19 Valpha1-Vbeta16 Type-II Natural Killer T cell receptor
PDB Compounds: (D:) Vbeta16 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4ei6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ei6d2 b.1.1.2 (D:116-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4ei6d2:

Click to download the PDB-style file with coordinates for d4ei6d2.
(The format of our PDB-style files is described here.)

Timeline for d4ei6d2: