Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d4ei6d1: 4ei6 D:3-115 [220560] Other proteins in same PDB: d4ei6a2, d4ei6b2, d4ei6c2, d4ei6d2 automated match to d1ktke1 |
PDB Entry: 4ei6 (more details), 1.6 Å
SCOPe Domain Sequences for d4ei6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ei6d1 b.1.1.0 (D:3-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kvlqipshqiidmgqmvtlncdpvsnhlyfywykqilgqqmeflvnfyngkvmeksklfk dqfsverpdgsyftlkiqptaledsavyfcassfwgayaeqffgpgtrltvle
Timeline for d4ei6d1: