SCOPe 2.08: Domain d4ei6c1: 4ei6 C:2-114

Lineage for d4ei6c1 (4ei6 C:2-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4ei6c1: 4ei6 C:2-114 [220558]
   Other proteins in same PDB: d4ei6a2, d4ei6b2, d4ei6c2, d4ei6d2
   automated match to d2f54d1

Details for d4ei6c1

PDB Entry: 4ei6, 1.6 Å

PDB Description: Structure of XV19 Valpha1-Vbeta16 Type-II Natural Killer T cell receptor

PDB Compounds: (C:) Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4ei6c1:

Sequence; same for both SEQRES and ATOM records:

>d4ei6c1 b.1.1.0 (C:2-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qkvqqspeslsvpeggmaslnctssdrnfqyfwwyrqhsgegpkalmsifsdgdkkegrf
tahlnkaslhvslhirdsqpsdsalyfcaaseqnnyaqgltfglgtrvsvfpy

Timeline for d4ei6c1:

• d4ei6c1 first appeared in SCOPe 2.03
  
• d4ei6c1 appears in SCOPe 2.07