SCOPe 2.06: Domain d4egqb2: 4egq B:103-312

Lineage for d4egqb2 (4egq B:103-312)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (32 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [226352] (1 PDB entry)

8. Domain d4egqb2: 4egq B:103-312 [220529]
   Other proteins in same PDB: d4egqa1, d4egqb1, d4egqc1, d4egqd1
   automated match to d1e4ea2

Details for d4egqb2

PDB Entry: 4egq, 2.2 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase b from burkholderia pseudomallei

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egqb2:

Sequence, based on SEQRES records:

>d4egqb2 d.142.1.0 (B:103-312) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dkfrtklvwqqtgiptppfetvmrgddyaaraqdivaklgvplfvkpasegssvavekvk
sadalpaaleeaakhdkiviveksiegggeytaciaadldlplirivpagefydyhakyi
andtqylipcgldaakeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgm
tdhslppkaaravgigyselvvkvlsltld

Sequence, based on observed residues (ATOM records):

>d4egqb2 d.142.1.0 (B:103-312) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dkfrtklvwqqtgiptppfetvmrgddyaaraqdivaklgvplfvkpasvekvksadalp
aaleeaakhdkiviveksiegggeytaciaadldlplirivpagefydyhakyiandtqy
lipcgldaakeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslp
pkaaravgigyselvvkvlsltld

Timeline for d4egqb2:

• d4egqb2 first appeared in SCOPe 2.03
  
• d4egqb2 appears in SCOPe 2.05
  
• d4egqb2 appears in SCOPe 2.07
  
• d4egqb2 appears in the current release, SCOPe 2.08