Lineage for d4egqa2 (4egq A:103-311)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541793Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2541794Protein automated matches [226904] (37 species)
    not a true protein
  7. 2541824Species Burkholderia pseudomallei [TaxId:320372] [226352] (3 PDB entries)
  8. 2541825Domain d4egqa2: 4egq A:103-311 [220527]
    Other proteins in same PDB: d4egqa1, d4egqb1, d4egqc1, d4egqd1
    automated match to d1e4ea2

Details for d4egqa2

PDB Entry: 4egq (more details), 2.2 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase b from burkholderia pseudomallei
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egqa2:

Sequence, based on SEQRES records: (download)

>d4egqa2 d.142.1.0 (A:103-311) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dkfrtklvwqqtgiptppfetvmrgddyaaraqdivaklgvplfvkpasegssvavekvk
sadalpaaleeaakhdkiviveksiegggeytaciaadldlplirivpagefydyhakyi
andtqylipcgldaakeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgm
tdhslppkaaravgigyselvvkvlsltl

Sequence, based on observed residues (ATOM records): (download)

>d4egqa2 d.142.1.0 (A:103-311) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dkfrtklvwqqtgiptppfetvmrgddyaaraqdivaklgvplfvkpassvavekvksad
alpaaleeaakhdkiviveksiegggeytaciaadldlplirivpylipcgldaakeaef
kriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravgigysel
vvkvlsltl

SCOPe Domain Coordinates for d4egqa2:

Click to download the PDB-style file with coordinates for d4egqa2.
(The format of our PDB-style files is described here.)

Timeline for d4egqa2: