Lineage for d4egjd2 (4egj D:103-312)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928777Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1928778Protein automated matches [226904] (27 species)
    not a true protein
  7. 1928800Species Burkholderia xenovorans [TaxId:266265] [226416] (1 PDB entry)
  8. 1928804Domain d4egjd2: 4egj D:103-312 [220513]
    Other proteins in same PDB: d4egja1, d4egjb1, d4egjc1, d4egjd1
    automated match to d1e4ea2

Details for d4egjd2

PDB Entry: 4egj (more details), 2.3 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans
PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egjd2:

Sequence, based on SEQRES records: (download)

>d4egjd2 d.142.1.0 (D:103-312) automated matches {Burkholderia xenovorans [TaxId: 266265]}
dkfrtklvwqqlgiptppfeavlrgddyearakeivaklglplfvkpasegssvavikvk
sadalpaalieavkfdrivvveksiegggeytaciagnldlpvirivpagefydyhakyi
andtqylipcgltadeearlkvlarrafdvlgctdwgradfmldadgnpyflevntapgm
tdhslppkaaravgisyqelvvavlaltlk

Sequence, based on observed residues (ATOM records): (download)

>d4egjd2 d.142.1.0 (D:103-312) automated matches {Burkholderia xenovorans [TaxId: 266265]}
dkfrtklvwqqlgiptppfeaglplfvkvvveksiegggeytaciagnldlpvirivpat
qylipcgltadeearlkvlarrafdvlgctdwgradfmldadgnpyflevntapgmtdhs
lppkaaravgisyqelvvavlaltlk

SCOPe Domain Coordinates for d4egjd2:

Click to download the PDB-style file with coordinates for d4egjd2.
(The format of our PDB-style files is described here.)

Timeline for d4egjd2: