SCOPe 2.04: Domain d4egjb2: 4egj B:103-311

Lineage for d4egjb2 (4egj B:103-311)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (25 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226416] (1 PDB entry)

8. Domain d4egjb2: 4egj B:103-311 [220509]
   Other proteins in same PDB: d4egja1, d4egjb1, d4egjc1, d4egjd1
   automated match to d1e4ea2

Details for d4egjb2

PDB Entry: 4egj, 2.3 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egjb2:

Sequence, based on SEQRES records:

>d4egjb2 d.142.1.0 (B:103-311) automated matches {Burkholderia xenovorans [TaxId: 266265]}
dkfrtklvwqqlgiptppfeavlrgddyearakeivaklglplfvkpasegssvavikvk
sadalpaalieavkfdrivvveksiegggeytaciagnldlpvirivpagefydyhakyi
andtqylipcgltadeearlkvlarrafdvlgctdwgradfmldadgnpyflevntapgm
tdhslppkaaravgisyqelvvavlaltl

Sequence, based on observed residues (ATOM records):

>d4egjb2 d.142.1.0 (B:103-311) automated matches {Burkholderia xenovorans [TaxId: 266265]}
dkfrtklvwqqlgiptppfeavlrgddyearakeivaklglplfvkpaseikvksadalp
aalieavkfdrivvveksiegggeytaciagnldlpvirivqylipcgltadeearlkvl
arrafdvlgctdwgradfmldadgnpyflevntapgmtdhslppkaaravgisyqelvva
vlaltl

Timeline for d4egjb2:

• d4egjb2 first appeared in SCOPe 2.03
  
• d4egjb2 appears in SCOPe 2.05
  
• d4egjb2 appears in the current release, SCOPe 2.08