Class a: All alpha proteins [46456] (289 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (13 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries) |
Domain d4eg8b2: 4eg8 B:607-767 [220493] Other proteins in same PDB: d4eg8a1, d4eg8b1, d4eg8b3 automated match to d1rqga1 protein/RNA complex; complexed with 0p6, dms, gol, met |
PDB Entry: 4eg8 (more details), 2.6 Å
SCOPe Domain Sequences for d4eg8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eg8b2 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]} adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst
Timeline for d4eg8b2: