SCOPe 2.06: Domain d4eg1b2: 4eg1 B:607-768

Lineage for d4eg1b2 (4eg1 B:607-768)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (8 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [226468] (27 PDB entries)

8. Domain d4eg1b2: 4eg1 B:607-768 [220471]
   Other proteins in same PDB: d4eg1a1, d4eg1b1, d4eg1b3
   automated match to d1rqga1
   protein/RNA complex; complexed with gol, met

Details for d4eg1b2

PDB Entry: 4eg1, 2.9 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with substrate methionine

PDB Compounds: (B:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d4eg1b2:

Sequence; same for both SEQRES and ATOM records:

>d4eg1b2 a.27.1.0 (B:607-768) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste

Timeline for d4eg1b2:

• d4eg1b2 first appeared in SCOPe 2.03
  
• d4eg1b2 appears in SCOPe 2.05
  
• d4eg1b2 appears in SCOPe 2.07
  
• d4eg1b2 appears in the current release, SCOPe 2.08