Class a: All alpha proteins [46456] (285 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (7 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [226468] (6 PDB entries) |
Domain d4eg1b2: 4eg1 B:607-768 [220471] Other proteins in same PDB: d4eg1b1 automated match to d1rqga1 protein/RNA complex; complexed with gol, met |
PDB Entry: 4eg1 (more details), 2.9 Å
SCOPe Domain Sequences for d4eg1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eg1b2 a.27.1.0 (B:607-768) automated matches {Trypanosoma brucei [TaxId: 999953]} adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste
Timeline for d4eg1b2: