Lineage for d4eg1b2 (4eg1 B:607-768)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487290Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1487291Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1487344Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1487345Protein automated matches [226872] (7 species)
    not a true protein
  7. 1487364Species Trypanosoma brucei [TaxId:999953] [226468] (6 PDB entries)
  8. 1487369Domain d4eg1b2: 4eg1 B:607-768 [220471]
    Other proteins in same PDB: d4eg1b1
    automated match to d1rqga1
    protein/RNA complex; complexed with gol, met

Details for d4eg1b2

PDB Entry: 4eg1 (more details), 2.9 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with substrate methionine
PDB Compounds: (B:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d4eg1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eg1b2 a.27.1.0 (B:607-768) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste

SCOPe Domain Coordinates for d4eg1b2:

Click to download the PDB-style file with coordinates for d4eg1b2.
(The format of our PDB-style files is described here.)

Timeline for d4eg1b2: