Lineage for d4eg1b1 (4eg1 B:-4-371,B:386-606)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359851Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1359852Protein automated matches [190459] (31 species)
    not a true protein
  7. 1359993Species Trypanosoma brucei [TaxId:999953] [226467] (5 PDB entries)
  8. 1359998Domain d4eg1b1: 4eg1 B:-4-371,B:386-606 [220470]
    Other proteins in same PDB: d4eg1b2
    automated match to d1rqga2
    protein/RNA complex; complexed with gol, met

Details for d4eg1b1

PDB Entry: 4eg1 (more details), 2.9 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with substrate methionine
PDB Compounds: (B:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d4eg1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eg1b1 c.26.1.0 (B:-4-371,B:386-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
gdiylgryegwysisdesflXpckvslesghvvtwvseenymfrlsafrerllewyhanp
gcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltnyltg
srlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpkkiva
hgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlng
el

SCOPe Domain Coordinates for d4eg1b1:

Click to download the PDB-style file with coordinates for d4eg1b1.
(The format of our PDB-style files is described here.)

Timeline for d4eg1b1: