Lineage for d4effa_ (4eff A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614432Species Burkholderia pseudomallei [TaxId:28450] [225995] (3 PDB entries)
  8. 1614437Domain d4effa_: 4eff A: [220463]
    automated match to d1yaaa_
    complexed with gol

Details for d4effa_

PDB Entry: 4eff (more details), 1.85 Å

PDB Description: crystal structure of aromatic-amino-acid aminotransferase from burkholderia pseudomallei
PDB Compounds: (A:) Aromatic-amino-acid aminotransferase

SCOPe Domain Sequences for d4effa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4effa_ c.67.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
lglneafnadtrptkvnlgvgvytnedgkipllravrdaekarveaglprgylpidgiaa
ydasvqklllgddspliaagrvvtaqalggtgalkigadflrtlnpkakvaisdpswenh
ralfdmagfevvaypyydaktngvnfdgmlaalngyepgtivvlhacchnptgvdlndaq
waqvvevvkarrlvpfldiayqgfgesieadaaavrlfaaanlnvfvsssfsksfslyge
rvgalsiitdskdeaarvlsqlkrvirtnysnppthggaivaavlaspelraswvqelge
mrdriramrnglverlkaagierdfsfinaqrgmfsysgltsaqvdrlreefgiyavstg
ricvaalntrnldvvanaiaavl

SCOPe Domain Coordinates for d4effa_:

Click to download the PDB-style file with coordinates for d4effa_.
(The format of our PDB-style files is described here.)

Timeline for d4effa_: