SCOPe 2.04: Domain d1cd9d2: 1cd9 D:108-213

Lineage for d1cd9d2 (1cd9 D:108-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)

8. Domain d1cd9d2: 1cd9 D:108-213 [22044]
   Other proteins in same PDB: d1cd9a_, d1cd9c_
   complexed with nag

Details for d1cd9d2

PDB Entry: 1cd9, 2.8 Å

PDB Description: 2:2 complex of g-csf with its receptor

PDB Compounds: (D:) protein (g-csf receptor)

SCOPe Domain Sequences for d1cd9d2:

Sequence, based on SEQRES records:

>d1cd9d2 b.1.2.1 (D:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}
kleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhl
psskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptm

Sequence, based on observed residues (ATOM records):

>d1cd9d2 b.1.2.1 (D:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}
kleppmlqaldqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfe
lcglhqapvytlqmrcirsslpgfwspwspglqlrptm

Timeline for d1cd9d2:

• d1cd9d2 first appeared (with stable ids) in SCOP 1.55
  
• d1cd9d2 appears in SCOPe 2.03
  
• d1cd9d2 appears in SCOPe 2.05
  
• d1cd9d2 appears in the current release, SCOPe 2.08