SCOPe 2.08: Domain d4ee0a2: 4ee0 A:76-199

Lineage for d4ee0a2 (4ee0 A:76-199)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d4ee0a2: 4ee0 A:76-199 [220435]
   Other proteins in same PDB: d4ee0a1, d4ee0b1, d4ee0b3
   automated match to d1pd211
   complexed with 0o4, gsf, mg

Details for d4ee0a2

PDB Entry: 4ee0, 1.75 Å

PDB Description: Crystal structure of hH-PGDS with water displacing inhibitor

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4ee0a2:

Sequence; same for both SEQRES and ATOM records:

>d4ee0a2 a.45.1.1 (A:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d4ee0a2:

• d4ee0a2 first appeared in SCOPe 2.03
  
• d4ee0a2 appears in SCOPe 2.07