Lineage for d4eb5c_ (4eb5 C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446741Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1446742Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1446784Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 1446785Protein automated matches [190942] (3 species)
    not a true protein
  7. 1446790Species Archaeoglobus fulgidus [TaxId:224325] [226363] (2 PDB entries)
  8. 1446791Domain d4eb5c_: 4eb5 C: [220401]
    Other proteins in same PDB: d4eb5a_, d4eb5b_
    automated match to d1r9pa_
    complexed with epe, fes, gol, plp

Details for d4eb5c_

PDB Entry: 4eb5 (more details), 2.53 Å

PDB Description: A. fulgidus IscS-IscU complex structure
PDB Compounds: (C:) NifU protein (NifU-1)

SCOPe Domain Sequences for d4eb5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eb5c_ d.224.1.0 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
ysdkvfdhfqnprnvgkiedadgvgtvgnpvcgdlmtiyikvkdnriedikfqtfgcaaa
iatssmatemakgktieealkitrdavaealgglpkqkmhcsnlaadalrraivdyfrkn
gkidkikelglekelekm

SCOPe Domain Coordinates for d4eb5c_:

Click to download the PDB-style file with coordinates for d4eb5c_.
(The format of our PDB-style files is described here.)

Timeline for d4eb5c_: