Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.0: automated matches [191547] (1 protein) not a true family |
Protein automated matches [190942] (7 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:224325] [226363] (2 PDB entries) |
Domain d4eb5c_: 4eb5 C: [220401] Other proteins in same PDB: d4eb5a_, d4eb5b_ automated match to d1r9pa_ complexed with epe, fes, gol, plp |
PDB Entry: 4eb5 (more details), 2.53 Å
SCOPe Domain Sequences for d4eb5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eb5c_ d.224.1.0 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} ysdkvfdhfqnprnvgkiedadgvgtvgnpvcgdlmtiyikvkdnriedikfqtfgcaaa iatssmatemakgktieealkitrdavaealgglpkqkmhcsnlaadalrraivdyfrkn gkidkikelglekelekm
Timeline for d4eb5c_: