Lineage for d4eafa3 (4eaf A:336-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945237Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2945238Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins)
  6. 2945243Protein Thymidine phosphorylase [54682] (2 species)
  7. 2945244Species Escherichia coli [TaxId:562] [54683] (7 PDB entries)
  8. 2945246Domain d4eafa3: 4eaf A:336-440 [220390]
    Other proteins in same PDB: d4eafa1, d4eafa2, d4eafa4
    automated match to d2tpta3
    complexed with gol, so4

Details for d4eafa3

PDB Entry: 4eaf (more details), 1.55 Å

PDB Description: Thymidine phosphorylase from E.coli
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4eafa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eafa3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg
qrplavihakdennwqeaakavkaaikladkapestptvyrrise

SCOPe Domain Coordinates for d4eafa3:

Click to download the PDB-style file with coordinates for d4eafa3.
(The format of our PDB-style files is described here.)

Timeline for d4eafa3: