Lineage for d1egja_ (1egj A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54739Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
  7. 54740Species Human (Homo sapiens) [TaxId:9606] [49290] (2 PDB entries)
  8. 54741Domain d1egja_: 1egj A: [22039]
    Other proteins in same PDB: d1egjh1, d1egjh2, d1egjl1, d1egjl2

Details for d1egja_

PDB Entry: 1egj (more details), 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

SCOP Domain Sequences for d1egja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egja_ b.1.2.1 (A:) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens)}
iqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahsm
alpalepstrywarvrvrtsrtgyngiwsewsearswdtes

SCOP Domain Coordinates for d1egja_:

Click to download the PDB-style file with coordinates for d1egja_.
(The format of our PDB-style files is described here.)

Timeline for d1egja_: