Lineage for d1iarb2 (1iar B:97-197)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9907Protein Interleukin-4 receptor alpha chain [49287] (1 species)
  7. 9908Species Human (Homo sapiens) [TaxId:9606] [49288] (1 PDB entry)
  8. 9910Domain d1iarb2: 1iar B:97-197 [22038]
    Other proteins in same PDB: d1iara_

Details for d1iarb2

PDB Entry: 1iar (more details), 2.3 Å

PDB Description: interleukin-4 / receptor alpha chain complex

SCOP Domain Sequences for d1iarb2:

Sequence, based on SEQRES records: (download)

>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens)}
kprapgnltvhtnvsdtllltwsnpyppdnylynhltyavniwsendpadfriynvtyle
pslriaastlksgisyrarvrawaqaynttwsewspstkwh

Sequence, based on observed residues (ATOM records): (download)

>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens)}
kprapgnltvhdtllltwsnpyppdnylynhltyavniwsendpadfriynvtylepslr
iaagisyrarvrawaqaynttwsewspstkwh

SCOP Domain Coordinates for d1iarb2:

Click to download the PDB-style file with coordinates for d1iarb2.
(The format of our PDB-style files is described here.)

Timeline for d1iarb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iarb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1iara_