![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (20 proteins) |
![]() | Protein Interleukin-4 receptor alpha chain [49287] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49288] (1 PDB entry) |
![]() | Domain d1iarb1: 1iar B:1-96 [22037] Other proteins in same PDB: d1iara_ |
PDB Entry: 1iar (more details), 2.3 Å
SCOP Domain Sequences for d1iarb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iarb1 b.1.2.1 (B:1-96) Interleukin-4 receptor alpha chain {Human (Homo sapiens)} fkvlqeptcvsdymsistcewkmngptncstelrllyqlvfllseahtcipennggagcv chllmddvvsadnytldlwagqqllwkgsfkpsehv
Timeline for d1iarb1: