SCOPe 2.03: Domain d4e7pb_: 4e7p B:

Lineage for d4e7pb_ (4e7p B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (48 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:171101] [226388] (2 PDB entries)

8. Domain d4e7pb_: 4e7p B: [220357]
   automated match to d3ffwa_
   complexed with bef, mg

Details for d4e7pb_

PDB Entry: 4e7p, 1.89 Å

PDB Description: Crystal structure of receiver domain of putative NarL family response regulator spr1814 from Streptococcus pneumoniae in the presence of the phosphoryl analog beryllofluoride

PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d4e7pb_:

Sequence; same for both SEQRES and ATOM records:

>d4e7pb_ c.23.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
hmkvlvaedqsmlrdamcqlltlqpdvesvlqakngqeaiqllekesvdiaildvempvk
tglevlewirsekletkvvvvttfkragyferavkagvdayvlkersiadlmqtlhtvle
grkeyspelme

Timeline for d4e7pb_:

• d4e7pb_ is new in SCOPe 2.03-stable
  
• d4e7pb_ appears in SCOPe 2.04
  
• d4e7pb_ appears in the current release, SCOPe 2.08, called d4e7pb1