SCOP 1.65: Domain d1f6fb2: 1f6f B:101-203

Lineage for d1f6fb2 (1f6f B:101-203)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Prolactin receptor [49284] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49286] (1 PDB entry)

8. Domain d1f6fb2: 1f6f B:101-203 [22034]
   Other proteins in same PDB: d1f6fa_

Details for d1f6fb2

PDB Entry: 1f6f, 2.3 Å

PDB Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor

SCOP Domain Sequences for d1f6fb2:

Sequence, based on SEQRES records:

>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus)}
vepepprnltlevkqlkdkktylwvkwspptitdvktgwftmeyeirlkpeeaeeweihf
tghqtqfkvfdlypgqkylvqtrckpdhgywsrwsqessvemp

Sequence, based on observed residues (ATOM records):

>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus)}
vepepprnltlevkkktylwvkwspptitdvktgwftmeyeirlkpeeaeeweihftghq
tqfkvfdlypgqkylvqtrckpdhgywsrwsqessvemp

Timeline for d1f6fb2:

• d1f6fb2 first appeared (with stable ids) in SCOP 1.55
  
• d1f6fb2 appears in SCOP 1.63
  
• d1f6fb2 appears in SCOP 1.67
  
• d1f6fb2 appears in the current release, SCOPe 2.08