Lineage for d4e6mf2 (4e6m F:123-400)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837103Protein Putative dehydratase protein STM2273 [141846] (2 species)
  7. 2837104Species Salmonella enterica [TaxId:90371] [226347] (1 PDB entry)
  8. 2837110Domain d4e6mf2: 4e6m F:123-400 [220334]
    Other proteins in same PDB: d4e6ma1, d4e6ma3, d4e6mb1, d4e6mb3, d4e6mc1, d4e6mc3, d4e6md1, d4e6md3, d4e6me1, d4e6me3, d4e6mf1, d4e6mf3, d4e6mg1, d4e6mg3, d4e6mh1, d4e6mh3
    automated match to d2gl5a1
    complexed with epe, mg, mpd

Details for d4e6mf2

PDB Entry: 4e6m (more details), 1.8 Å

PDB Description: Crystal structure of Putative dehydratase protein from Salmonella enterica subsp. enterica serovar Typhimurium (Salmonella typhimurium)
PDB Compounds: (F:) putative dehydratase protein

SCOPe Domain Sequences for d4e6mf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6mf2 c.1.11.2 (F:123-400) Putative dehydratase protein STM2273 {Salmonella enterica [TaxId: 90371]}
ktneklrtyasqlqfgwgdkrhilvtpeeyaeaaraalddgydaikvdpleidrngddcv
fqnrnrnysgllladqlkmgeariaamreamgddadiiveihsllgtnsaiqfakaieky
riflyeepihplnsdnmqkvsrsttipiatgersytrwgyrellekqsiavaqpdlclcg
gitegkkicdyaniydttvqvhvcggpvstvaalhmetaipnfiihehhtnamkasirel
cthdyqpengyyvapeqpglgqelndevvkeylayvik

SCOPe Domain Coordinates for d4e6mf2:

Click to download the PDB-style file with coordinates for d4e6mf2.
(The format of our PDB-style files is described here.)

Timeline for d4e6mf2: