Lineage for d4e6mc2 (4e6m C:123-400)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1343858Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins)
  6. 1344029Protein Putative dehydratase protein STM2273 [141846] (2 species)
  7. 1344030Species Salmonella enterica [TaxId:90371] [226347] (1 PDB entry)
  8. 1344033Domain d4e6mc2: 4e6m C:123-400 [220328]
    Other proteins in same PDB: d4e6ma1, d4e6mb1, d4e6mc1, d4e6md1, d4e6me1, d4e6mf1, d4e6mg1, d4e6mh1
    automated match to d2gl5a1
    complexed with epe, mg, mpd

Details for d4e6mc2

PDB Entry: 4e6m (more details), 1.8 Å

PDB Description: Crystal structure of Putative dehydratase protein from Salmonella enterica subsp. enterica serovar Typhimurium (Salmonella typhimurium)
PDB Compounds: (C:) putative dehydratase protein

SCOPe Domain Sequences for d4e6mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6mc2 c.1.11.2 (C:123-400) Putative dehydratase protein STM2273 {Salmonella enterica [TaxId: 90371]}
ktneklrtyasqlqfgwgdkrhilvtpeeyaeaaraalddgydaikvdpleidrngddcv
fqnrnrnysgllladqlkmgeariaamreamgddadiiveihsllgtnsaiqfakaieky
riflyeepihplnsdnmqkvsrsttipiatgersytrwgyrellekqsiavaqpdlclcg
gitegkkicdyaniydttvqvhvcggpvstvaalhmetaipnfiihehhtnamkasirel
cthdyqpengyyvapeqpglgqelndevvkeylayvik

SCOPe Domain Coordinates for d4e6mc2:

Click to download the PDB-style file with coordinates for d4e6mc2.
(The format of our PDB-style files is described here.)

Timeline for d4e6mc2: