![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein Putative dehydratase protein STM2273 [143250] (2 species) |
![]() | Species Salmonella enterica [TaxId:90371] [226346] (1 PDB entry) |
![]() | Domain d4e6mc1: 4e6m C:1-122 [220327] Other proteins in same PDB: d4e6ma2, d4e6ma3, d4e6mb2, d4e6mb3, d4e6mc2, d4e6mc3, d4e6md2, d4e6md3, d4e6me2, d4e6me3, d4e6mf2, d4e6mf3, d4e6mg2, d4e6mg3, d4e6mh2, d4e6mh3 automated match to d2gl5a2 complexed with epe, mg, mpd |
PDB Entry: 4e6m (more details), 1.8 Å
SCOPe Domain Sequences for d4e6mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e6mc1 d.54.1.1 (C:1-122) Putative dehydratase protein STM2273 {Salmonella enterica [TaxId: 90371]} mkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiirdl aplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyqll gg
Timeline for d4e6mc1: