Lineage for d4e6mb1 (4e6m B:1-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947859Protein Putative dehydratase protein STM2273 [143250] (2 species)
  7. 2947860Species Salmonella enterica [TaxId:90371] [226346] (1 PDB entry)
  8. 2947862Domain d4e6mb1: 4e6m B:1-122 [220325]
    Other proteins in same PDB: d4e6ma2, d4e6ma3, d4e6mb2, d4e6mb3, d4e6mc2, d4e6mc3, d4e6md2, d4e6md3, d4e6me2, d4e6me3, d4e6mf2, d4e6mf3, d4e6mg2, d4e6mg3, d4e6mh2, d4e6mh3
    automated match to d2gl5a2
    complexed with epe, mg, mpd

Details for d4e6mb1

PDB Entry: 4e6m (more details), 1.8 Å

PDB Description: Crystal structure of Putative dehydratase protein from Salmonella enterica subsp. enterica serovar Typhimurium (Salmonella typhimurium)
PDB Compounds: (B:) putative dehydratase protein

SCOPe Domain Sequences for d4e6mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6mb1 d.54.1.1 (B:1-122) Putative dehydratase protein STM2273 {Salmonella enterica [TaxId: 90371]}
mkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiirdl
aplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyqll
gg

SCOPe Domain Coordinates for d4e6mb1:

Click to download the PDB-style file with coordinates for d4e6mb1.
(The format of our PDB-style files is described here.)

Timeline for d4e6mb1: