SCOP 1.65: Domain d1bp3b2: 1bp3 B:301-404

Lineage for d1bp3b2 (1bp3 B:301-404)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Prolactin receptor [49284] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49285] (1 PDB entry)

8. Domain d1bp3b2: 1bp3 B:301-404 [22032]
   Other proteins in same PDB: d1bp3a_
   complexed with zn; mutant

Details for d1bp3b2

PDB Entry: 1bp3, 2.9 Å

PDB Description: the xray structure of a growth hormone-prolactin receptor complex

SCOP Domain Sequences for d1bp3b2:

Sequence; same for both SEQRES and ATOM records:

>d1bp3b2 b.1.2.1 (B:301-404) Prolactin receptor {Human (Homo sapiens)}
vqpdpplelavevkqpedrkpylwikwspptlidlktgwftllyeirlkpekaaeweihf
agqqtefkilslhpgqkylvqvrckpdhgywsawspatfiqips

Timeline for d1bp3b2:

• d1bp3b2 first appeared (with stable ids) in SCOP 1.55
  
• d1bp3b2 appears in SCOP 1.63
  
• d1bp3b2 appears in SCOP 1.67
  
• d1bp3b2 appears in the current release, SCOPe 2.08