Lineage for d4e4jf_ (4e4j F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580827Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2580828Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2580977Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2580978Protein automated matches [190175] (10 species)
    not a true protein
  7. 2581056Species Mycoplasma penetrans [TaxId:272633] [226512] (1 PDB entry)
  8. 2581062Domain d4e4jf_: 4e4j F: [220293]
    automated match to d1rxxa_
    complexed with cl

Details for d4e4jf_

PDB Entry: 4e4j (more details), 2.3 Å

PDB Description: Crystal structure of arginine deiminase from Mycoplasma penetrans
PDB Compounds: (F:) Arginine deiminase

SCOPe Domain Sequences for d4e4jf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4jf_ d.126.1.0 (F:) automated matches {Mycoplasma penetrans [TaxId: 272633]}
ginvyseigelkevlvhtpgdeirytapsrleellfsavlkadtaieehkgfvkilqnng
ikviqlcdlvaetyelcskevrnsfieqyldealpvlkkeirpvvkdyllsfptvqmvrk
mmsgilanelnikqdnpliidgmpnlyftrdpfasmgngvsincmkyptrkrevifsrfv
ftnnpkykntpryfdivgnngtieggdifiynsktlvignsertnfaaiesvakniqank
dctferivvinvppmpnlmhldtwltmldydkflyspnmmnvlkiweidlnvkpvkfvek
kgtleevlysiidkkpilipiagkganqldidiethfdgtnyltiapgvvvgyernektq
kalveagikvlsfngsqlslgmgsarcmsmplirenlkk

SCOPe Domain Coordinates for d4e4jf_:

Click to download the PDB-style file with coordinates for d4e4jf_.
(The format of our PDB-style files is described here.)

Timeline for d4e4jf_: