SCOP 1.75: Domain d1cn4b1: 1cn4 B:8-116

Lineage for d1cn4b1 (1cn4 B:8-116)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Erythropoietin (EPO) receptor [49282] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)

8. Domain d1cn4b1: 1cn4 B:8-116 [22029]
   Other proteins in same PDB: d1cn4c_

Details for d1cn4b1

PDB Entry: 1cn4, 2.8 Å

PDB Description: erythropoietin complexed with extracellular domains of erythropoietin receptor

PDB Compounds: (B:) protein (erythropoietin receptor)

SCOP Domain Sequences for d1cn4b1:

Sequence; same for both SEQRES and ATOM records:

>d1cn4b1 b.1.2.1 (B:8-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
dpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklc
rlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d1cn4b1:

• d1cn4b1 first appeared (with stable ids) in SCOP 1.55
  
• d1cn4b1 appears in SCOP 1.73
  
• d1cn4b1 appears in SCOPe 2.01
  
• d1cn4b1 appears in the current release, SCOPe 2.08