Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (31 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226081] (2 PDB entries) |
Domain d4e4ea2: 4e4e A:91-206 [220281] Other proteins in same PDB: d4e4ea1, d4e4eb1, d4e4ec1, d4e4ed1 automated match to d1kkca2 complexed with mn; mutant |
PDB Entry: 4e4e (more details), 1.88 Å
SCOPe Domain Sequences for d4e4ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4ea2 d.44.1.0 (A:91-206) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdagk
Timeline for d4e4ea2: