SCOPe 2.06: Domain d4e42c1: 4e42 C:1-110

Lineage for d4e42c1 (4e42 C:1-110)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4e42c1: 4e42 C:1-110 [220268]
   Other proteins in same PDB: d4e42a2, d4e42b2, d4e42c2, d4e42d2
   automated match to d2f54d1
   complexed with cl, na, no3; mutant

Details for d4e42c1

PDB Entry: 4e42, 2.7 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4

PDB Compounds: (C:) T cell receptor G4 alpha chain

SCOPe Domain Sequences for d4e42c1:

Sequence, based on SEQRES records:

>d4e42c1 b.1.1.0 (C:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcavdrgstlgrlyfgrgtqltvwpd

Sequence, based on observed residues (ATOM records):

>d4e42c1 b.1.1.0 (C:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcavdrlyfgrgtqltvwpd

Timeline for d4e42c1:

• d4e42c1 first appeared in SCOPe 2.03
  
• d4e42c1 appears in SCOPe 2.05
  
• d4e42c1 appears in SCOPe 2.07
  
• d4e42c1 appears in the current release, SCOPe 2.08