Lineage for d4e42b2 (4e42 B:111-238)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517673Domain d4e42b2: 4e42 B:111-238 [220267]
    Other proteins in same PDB: d4e42a1, d4e42b1, d4e42c1, d4e42d1
    automated match to d2esve2
    complexed with cl, na, no3; mutant

Details for d4e42b2

PDB Entry: 4e42 (more details), 2.7 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (B:) T cell receptor G4 beta chain

SCOPe Domain Sequences for d4e42b2:

Sequence, based on SEQRES records: (download)

>d4e42b2 b.1.1.2 (B:111-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Sequence, based on observed residues (ATOM records): (download)

>d4e42b2 b.1.1.2 (B:111-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpasryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgra

SCOPe Domain Coordinates for d4e42b2:

Click to download the PDB-style file with coordinates for d4e42b2.
(The format of our PDB-style files is described here.)

Timeline for d4e42b2: