Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4e41i2: 4e41 I:111-198 [220261] Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41b2, d4e41d1, d4e41e1, d4e41f1, d4e41f2, d4e41g1, d4e41g2, d4e41i1, d4e41j1 automated match to d2f54d2 complexed with na; mutant |
PDB Entry: 4e41 (more details), 2.6 Å
SCOPe Domain Sequences for d4e41i2:
Sequence, based on SEQRES records: (download)
>d4e41i2 b.1.1.2 (I:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
>d4e41i2 b.1.1.2 (I:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqkpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw snacanafnnsiipedtffp
Timeline for d4e41i2: