SCOPe 2.04: Domain d4e41g2: 4e41 G:93-190

Lineage for d4e41g2 (4e41 G:93-190)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (40 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d4e41g2: 4e41 G:93-190 [220259]
   Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41d1, d4e41d2, d4e41e1, d4e41e2, d4e41f1, d4e41f2, d4e41g1, d4e41i1, d4e41i2, d4e41j1, d4e41j2
   automated match to d1klub1
   complexed with na; mutant

Details for d4e41g2

PDB Entry: 4e41, 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4

PDB Compounds: (G:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d4e41g2:

Sequence, based on SEQRES records:

>d4e41g2 b.1.1.2 (G:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d4e41g2 b.1.1.2 (G:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvm
letvsgevytcqvehpsvtspltvewra

Timeline for d4e41g2:

• d4e41g2 first appeared in SCOPe 2.03
  
• d4e41g2 appears in SCOPe 2.05
  
• d4e41g2 appears in the current release, SCOPe 2.08