SCOPe 2.05: Domain d4e41f2: 4e41 F:82-181

Lineage for d4e41f2 (4e41 F:82-181)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d4e41f2: 4e41 F:82-181 [220257]
   Other proteins in same PDB: d4e41a1, d4e41b1, d4e41b2, d4e41d1, d4e41d2, d4e41e1, d4e41e2, d4e41f1, d4e41g1, d4e41g2, d4e41i1, d4e41i2, d4e41j1, d4e41j2
   automated match to d1jwua1
   complexed with na; mutant

Details for d4e41f2

PDB Entry: 4e41, 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4

PDB Compounds: (F:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4e41f2:

Sequence; same for both SEQRES and ATOM records:

>d4e41f2 b.1.1.2 (F:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d4e41f2:

• d4e41f2 first appeared in SCOPe 2.03
  
• d4e41f2 appears in SCOPe 2.04
  
• d4e41f2 appears in SCOPe 2.06
  
• d4e41f2 appears in the current release, SCOPe 2.08