SCOPe 2.05: Domain d4e41e2: 4e41 E:111-238

Lineage for d4e41e2 (4e41 E:111-238)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4e41e2: 4e41 E:111-238 [220255]
   Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41b2, d4e41d1, d4e41e1, d4e41f1, d4e41f2, d4e41g1, d4e41g2, d4e41i1, d4e41j1
   automated match to d2esve2
   complexed with na; mutant

Details for d4e41e2

PDB Entry: 4e41, 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4

PDB Compounds: (E:) T cell receptor G4 beta chain

SCOPe Domain Sequences for d4e41e2:

Sequence; same for both SEQRES and ATOM records:

>d4e41e2 b.1.1.2 (E:111-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4e41e2:

• d4e41e2 first appeared in SCOPe 2.03
  
• d4e41e2 appears in SCOPe 2.04
  
• d4e41e2 appears in SCOPe 2.06
  
• d4e41e2 appears in the current release, SCOPe 2.08