SCOPe 2.04: Domain d4e41e1: 4e41 E:1-110

Lineage for d4e41e1 (4e41 E:1-110)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4e41e1: 4e41 E:1-110 [220254]
   Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41b2, d4e41d2, d4e41e2, d4e41f1, d4e41f2, d4e41g1, d4e41g2, d4e41i2, d4e41j2
   automated match to d2ak4e1
   complexed with na; mutant

Details for d4e41e1

PDB Entry: 4e41, 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4

PDB Compounds: (E:) T cell receptor G4 beta chain

SCOPe Domain Sequences for d4e41e1:

Sequence, based on SEQRES records:

>d4e41e1 b.1.1.0 (E:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqspthliktrgqqatlrcspisghtsvywyqqalglglqfllwydegeernrgnfpp
rfsgrqfpnysselnvnaleledsalylcassqiretqyfgpgtrllvle

Sequence, based on observed residues (ATOM records):

>d4e41e1 b.1.1.0 (E:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqspthliktrgqqatlrcspisghtsvywyqqalglqfllwydegeernrgnfpprf
sgrqfpnysselnvnaleledsalylcassqiretqyfgpgtrllvle

Timeline for d4e41e1:

• d4e41e1 first appeared in SCOPe 2.03
  
• d4e41e1 appears in SCOPe 2.05
  
• d4e41e1 appears in the current release, SCOPe 2.08