Lineage for d4e41d2 (4e41 D:111-199)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750703Domain d4e41d2: 4e41 D:111-199 [220253]
    Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41b2, d4e41d1, d4e41e1, d4e41f1, d4e41f2, d4e41g1, d4e41g2, d4e41i1, d4e41j1
    automated match to d2f54d2
    complexed with na; mutant

Details for d4e41d2

PDB Entry: 4e41 (more details), 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (D:) T cell receptor G4 alpha chain

SCOPe Domain Sequences for d4e41d2:

Sequence, based on SEQRES records: (download)

>d4e41d2 b.1.1.2 (D:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4e41d2 b.1.1.2 (D:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqkpdpavyqlrdsvclftdfdsqtnvsqyitdkcvldmrsmdfksnsavawsacanafn
siipedtffps

SCOPe Domain Coordinates for d4e41d2:

Click to download the PDB-style file with coordinates for d4e41d2.
(The format of our PDB-style files is described here.)

Timeline for d4e41d2: